SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011107 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011107
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.93e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000432
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 5-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000968
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011107   Gene: ENSOCUG00000012903   Transcript: ENSOCUT00000012904
Sequence length 626
Comment pep:known_by_projection scaffold:OryCun2.0:GL018727:856893:897688:1 gene:ENSOCUG00000012903 transcript:ENSOCUT00000012904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYELERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMTLYDSCYQIVGLVAVGQSLPPSAITEIKLHTNMFMFRASLDL
KLIFLDSRVTELTGYEPQDLIEKTLYHHVHSCDAFHLRYAHHLLLVKGQVTTKYYRLLSK
LGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTDIEYKELQLSLDQVSTSKSQDCWRAAL
STSQETRKLAKPKSTKMKTKLRTNPYPPQQYSAFQMDKLECGQLGTWRAEQQLPSESSDL
LYAPSCGLPFSYHYGHFPLDSHVFTSKKPMLPAKFGQPPGSPCEVARFFLSALPASGECQ
WHYASPLVPGSASPAKSLSEPPLAAARHSLVPNYEGPPGAGRCRPHDPLSPRLPSPECRH
HTDRPVFRQAEVRRSGQGADWFSLARAAPEYCAPPAREPPGRAGRSLPSCCSSTTACDAA
GAMRSRLPGAPRPHYLGASVIITNGR
Download sequence
Identical sequences G1T4B4
9986.ENSOCUP00000011107 ENSOCUP00000011107 ENSOCUP00000011107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]