SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011215 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000011215
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0471
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011215   Gene: ENSOCUG00000013030   Transcript: ENSOCUT00000013027
Sequence length 257
Comment pep:known_by_projection chromosome:OryCun2.0:19:44372250:44374513:-1 gene:ENSOCUG00000013030 transcript:ENSOCUT00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAVSTYAAYLGGYVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMI
QLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHHTRRVEFWNQMKLL
GESVGIFGAAVILATDG
Download sequence
Identical sequences G1T4K7
XP_002719476.1.1745 9986.ENSOCUP00000011215 ENSOCUP00000011215 ENSOCUP00000011215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]