SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011439 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011439
Domain Number 1 Region: 22-180
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.05e-35
Family Glyoxalase I (lactoylglutathione lyase) 0.000000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011439   Gene: ENSOCUG00000017258   Transcript: ENSOCUT00000013292
Sequence length 187
Comment pep:known_by_projection chromosome:OryCun2.0:12:28469779:28491196:-1 gene:ENSOCUG00000017258 transcript:ENSOCUT00000013292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAAMAEPQPASSGLTDEAAASCCSDADPSTKDFLMQQTMLRIKDPKKSLDFYTRILGMTL
IQKLDFPSMKFSLYFMAYEDKNDIPKDKNERVAWAFSRKATLELTHNWGTEDDETQSYHS
GNSDPRGFGHIGIAVPDVYGACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNP
NTVTSII
Download sequence
Identical sequences G1T545
ENSOCUP00000011439 9986.ENSOCUP00000011439 ENSOCUP00000011439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]