SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011454 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011454
Domain Number 1 Region: 198-361,394-455
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-33
Family Voltage-gated potassium channels 0.0048
Further Details:      
 
Domain Number 2 Region: 458-652
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-31
Family cAMP-binding domain 0.00069
Further Details:      
 
Domain Number 3 Region: 16-112
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011454   Gene: ENSOCUG00000013312   Transcript: ENSOCUT00000013310
Sequence length 992
Comment pep:known_by_projection chromosome:OryCun2.0:19:42985071:42997952:-1 gene:ENSOCUG00000013312 transcript:ENSOCUT00000013310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLH
KALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDITPRGGPGLGPP
GGHGDSNHESSLGRRGAGLKLRSARRQSRTVLHRLTGHFGRRAQPGMKANNNVFEPKPSV
PEYKVASVGGSRCLLLHYSVPKAIWDGLILLATFYVAVTVPYTCASRGDDEPVTSRHTLA
SDIAVEMLFTPDIILNFRTTYVSQSGQVISPRSIGLHYLATWFFVDLIAALPFDLLYVFN
ITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACVWYVIGRR
EMEANDPLLWDIGEPPTPAFTRRPPPPPRCCRHAPFLRSSNMESWYFTLSSLTSVGFGNV
CANTDAEKISICTMLIGALMHALVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPR
ALKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLR
ALSLHIKASFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPEP
GQEPGSGAGSSGVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYRTVFRAGLLRDLTF
NLRQGCDTSGLGRFSRSPRLSQPHSESLGSSSEKTLPSITEAEGGVEPGGGPRPRRPLLL
PNLSPARPRGSLVSLLGEELPPFSALVSSPSLSPSLSPALAGRGHSPSPHGPPRCSAAWK
PPQLLIPPLGTCGPPDLSPRIVDGIEDAGSTAEAPTFRFSRRPEVPRPRSQAPPTGTRPG
RELATSEAEEVKEKVCRLNQEICRLNQEVSQLSRELRHMIGLLQARLGAPGHPAGPAWPL
QFPCRQQRPPCISPCGSGPPPGLQDTTLAEVHCPASVGAAEVAATPLDLRPSMLPPCPSE
HDPLGPSPVPEGPAPSPRLPRHSFRSRSDAFH
Download sequence
Identical sequences G1T558
ENSOCUP00000011454 9986.ENSOCUP00000011454 ENSOCUP00000011454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]