SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011548 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011548
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 5.75e-56
Family SOUL heme-binding protein 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011548   Gene: ENSOCUG00000013425   Transcript: ENSOCUT00000013421
Sequence length 205
Comment pep:known_by_projection chromosome:OryCun2.0:12:128813575:128822261:1 gene:ENSOCUG00000013425 transcript:ENSOCUT00000013421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVLEPDPGTPEDAAAQDLETPVWTAPEDAGPQPGNYEIRHYGPAKWVSTSVESMDWDA
AVQTGFTKLSSYLQGNNEREMKIKMTAPVTSYVEPGSGPFSEATVTTSLYLPSEQQSDPP
RPSESGVFIEDRAGMTVFVRSFDGFSSAQKNQEQLLTLASILREEGKVFDEKVYYTAGYN
SPFKLLNRNNEVWLIQKNEASKESQ
Download sequence
Identical sequences G1T5D2
ENSOCUP00000011548 ENSOCUP00000011548 XP_002714892.1.1745 9986.ENSOCUP00000011548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]