SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011549 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011549
Domain Number 1 Region: 187-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.08e-41
Family NadC C-terminal domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0000942
Family NadC N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011549   Gene: ENSOCUG00000013417   Transcript: ENSOCUT00000013422
Sequence length 491
Comment pep:novel chromosome:OryCun2.0:7:42673421:42708377:-1 gene:ENSOCUG00000013417 transcript:ENSOCUT00000013422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYREHFQDDVFNEKGWNYILEKYDGHLPIEVKAVP
EGSVVPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPIPGY
SLPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPVVENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKKWSIENIAFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
RLNIELEADPH
Download sequence
Identical sequences G1T5D3
ENSOCUP00000011549 XP_002712079.1.1745 ENSOCUP00000011549 9986.ENSOCUP00000011549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]