SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011582 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011582
Domain Number 1 Region: 22-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.72e-115
Family Transferrin 0.000000216
Further Details:      
 
Domain Number 2 Region: 364-648
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.14e-94
Family Transferrin 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011582   Gene: ENSOCUG00000013463   Transcript: ENSOCUT00000013461
Sequence length 688
Comment pep:known chromosome:OryCun2.0:14:91788250:91804476:1 gene:ENSOCUG00000013463 transcript:ENSOCUT00000013461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCRSAAMWIFLALRTALGSVEVRWCTASEPEQQKCEDMSQAFREAGLQPALLCVQGTSA
DHCVQLIAAHEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVKRSSNVT
INTLRGVKSCHTGINRTVGWNVPVGYLVDSGRLSVMGCDVLKAVSEYFGGSCVPGAGETR
YSESLCRLCRGDTSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGRT
LPSWGHMLMSRDFELLCRDGSRASVTEWQHCHLARVPAHAVVVRADTDAGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKNLLFKDSTLELVPIATQTYEAWLGPEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFSRQRLKPEIQCVSAESPQHCMEQIQAGHIDAVTL
NGEDIHTAGKTYGLIPAAGELYAADDRSNSYFVVAVVKRDSAYAFTVDELRGKRSCHPGF
GSPAGWDVPVGALIHWGYIRPRNCDVLTAVGQFFNASCVPVNNPKKYPSSLCALCVGDEQ
GRNKCTGNSQERYYGDSGAFRCLVEGAGDVAFVKHTTIFDNTNGHNPEPWAAHLRSQDYE
LLCPNGARAEAHQFAACNLAQIPSHAVMVRPDTNIFTVYGLLDKAQVSQPRGHRGARALR
AAWGKLCDCHFGMSLQQPSPHPLHHSFF
Download sequence
Identical sequences G1T5G0
ENSOCUP00000011582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]