SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011728 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011728
Domain Number 1 Region: 612-872
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-81
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 278-380
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 496-597
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 4 Region: 385-486
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 5 Region: 165-271
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 6 Region: 97-169
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-16
Family Kringle modules 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011728   Gene: ENSOCUG00000013625   Transcript: ENSOCUT00000013627
Sequence length 873
Comment pep:known_by_projection chromosome:OryCun2.0:15:31393369:31466842:1 gene:ENSOCUG00000013625 transcript:ENSOCUT00000013627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTFARLVVALILGALSEVASFDPVLGYPLHRRHRPRSPLDPQDTYFLPDQRQQQSTPPP
PLVPRPPRALLAPRLHALQAGHTPRPHPGGCPASQSWVNVTDFGAPCLRWAEVPPFLERS
PPAGWVHLRGQRHNFCRSPDGAGSPWCFYGNVHGKVDWGYCDCRYGSVRLRGGRNEFEGT
VEVYAGGAWGAVCSSHWDDSDASVICHQLQLGGKGIAKQTSFSVLGLIPIYWSNVRCRGD
EENILLCEKDMWQGGPCPHKMAAAVTCSSYHGAALPIIRLAGGSTVHEGRVELYHAGQWG
TICDDQWDDADAEVICRQLGLSGIAKAWNQAYFGEGSGPIMLDEVRCTGNELSIEQCPKS
SWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKSSHEGRLEVYYRAQWGTVCDDGWTELNTY
VVCRQLGFKYGKQASANHFEESAGPIWLDDVSCSGKETSFLQCSRRQWGRHDCSHREDVA
VACYPGSDGHRLSLGFPIRLVDGENKKEGRVEVFISGQWGTICDDGWTDKDATVICRQLG
YKGPARARTMAYFGEGKGPIHVDNVKCTGSERSLADCIKQDIGKHNCRHSEDAGVICDYF
GKKASSNGDKKSLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCG
ATLLSSCWVLTAAHCFKRYGNNTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHKEYQPHS
SDYDIALVQLQGSQEQCVRFSSHVLPACLPFWRERPQKTASNCYITGWGDTGRAYSRTLQ
QAAVPLLPKRFCEERYKGQFTGRMLCAGNLHEHQRVDSCQGDSGGPLVCERSGGSWVVYG
VTSWGYGCGVKDSPGVYTRVSSFVPWIKSVTKL
Download sequence
Identical sequences G1T5T4
ENSOCUP00000011728 XP_002717220.2.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]