SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011857 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011857
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 6.31e-31
Family PaaI/YdiI-like 0.00000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011857   Gene: ENSOCUG00000013786   Transcript: ENSOCUT00000013782
Sequence length 113
Comment pep:known_by_projection chromosome:OryCun2.0:12:12322945:12327352:-1 gene:ENSOCUG00000013786 transcript:ENSOCUT00000013782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLVSAAPGKVICEMKVEEQHTNKLGTLHGGLTATLVDVISTVALMCTERGAPGVSVDLN
ITYMAPAKIGEDILITAHILKQGRTLAFASVDLTSKATGKLIAQGRHTKHLGN
Download sequence
Identical sequences G1T641
ENSOCUP00000011857 9986.ENSOCUP00000011857 ENSOCUP00000011857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]