SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011983 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011983
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily UBC-like 1.13e-42
Family UEV domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000011983
Domain Number - Region: 237-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00466
Family FCH domain 0.046
Further Details:      
 
Domain Number - Region: 152-210
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00942
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011983   Gene: ENSOCUG00000013940   Transcript: ENSOCUT00000013939
Sequence length 391
Comment pep:known_by_projection scaffold:OryCun2.0:GL018733:2393795:2440355:-1 gene:ENSOCUG00000013940 transcript:ENSOCUT00000013939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPTISASYPSYQATGPPNTSYMPGMPGGISAYPSGYP
PNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences G1T6E8
ENSOCUP00000011983 ENSOCUP00000011983 XP_002721412.1.1745 9986.ENSOCUP00000011983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]