SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012443 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012443
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily DNA clamp 1.88e-17
Family DNA polymerase processivity factor 0.016
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000012443
Domain Number - Region: 27-100
Classification Level Classification E-value
Superfamily DNA clamp 0.0198
Family DNA polymerase processivity factor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012443   Gene: ENSOCUG00000014474   Transcript: ENSOCUT00000014471
Sequence length 282
Comment pep:known_by_projection chromosome:OryCun2.0:11:56221803:56227280:-1 gene:ENSOCUG00000014474 transcript:ENSOCUT00000014471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQRIQDESVQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIRVTVENAKCVQ
ANAFIQAGIFQEFIVQEESITFRINLTVLLDCLSIFGSSPTPGTLTALRMCYQGYGHPLM
LFLEEGGVVTVCKINTQEPEDTLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMETFLCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIKNEDGQICFVEYYCCPDEEVCESEY
Download sequence
Identical sequences G1T7G8
XP_002714149.1.1745 XP_008260326.1.1745 ENSOCUP00000012443 ENSOCUP00000012443 9986.ENSOCUP00000012443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]