SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012560 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012560
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 2e-80
Family Integrin A (or I) domain 0.0000000201
Further Details:      
 
Domain Number 2 Region: 377-467
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-30
Family Integrin domains 0.0000808
Further Details:      
 
Domain Number 3 Region: 633-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.09e-18
Family Integrin beta tail domain 0.00035
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000246
Family Plexin repeat 0.00064
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Integrin beta EGF-like domains 0.0027
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000012560
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012560   Gene: ENSOCUG00000014602   Transcript: ENSOCUT00000014609
Sequence length 799
Comment pep:known_by_projection chromosome:OryCun2.0:14:94162627:94278659:1 gene:ENSOCUG00000014602 transcript:ENSOCUT00000014609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRALAPLYACLLVLCALVPRLPGLNICTSGSATSCEECLLIHPKCAWCSREDFGSPRSV
TSRCDLRENLVRNGCGGEVESPASSTHVLRSLPLSSKGSGPMGADVIQMTPQEVTVNLRP
GDKTSFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDSIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLLFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASDQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYSSIRSKVELSVWDQPEDLNLVFTATCQDGASYPGQRKCEGLKIGD
TASFEVSVEARSCPGRHTEHAFTLRPVGFRDSLQVRVTYNCTCGCSAGLEPDSSRCSGNG
TYICGLCECNPGYLGTRCECQEGENPSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRAKDGQ
ICSERGHCLCGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLHSGKPDNQSCHHR
CRDEVITRVDAIAKDDQEAVLCFYKTAQDCVMMFTYAELPSGKSNLTVLREPECGTAPNA
MTILLAVVGSILLVGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKLNKSYNGTID
Download sequence
Identical sequences G1T7R4
ENSOCUP00000012560 ENSOCUP00000012560 XP_017202531.1.1745 9986.ENSOCUP00000012560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]