SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012771 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012771
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 9.83e-85
Family Integrin A (or I) domain 0.0000000507
Further Details:      
 
Domain Number 2 Region: 371-457
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-22
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 621-703
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.44e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000288
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Integrin beta EGF-like domains 0.0021
Further Details:      
 
Domain Number 6 Region: 537-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000241
Family Integrin domains 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000012771
Domain Number - Region: 499-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012771   Gene: ENSOCUG00000014850   Transcript: ENSOCUT00000014854
Sequence length 786
Comment pep:known_by_projection chromosome:OryCun2.0:7:98994985:99081899:-1 gene:ENSOCUG00000014850 transcript:ENSOCUT00000014854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNECVQGGCALGGAETCEDCLLLGPQCAWCSQENFTHPSGVGERCD
TPANLLAKGCQLSFIENPVSQVEILKNKPLSVGRQQNSSDIVQIAPQSLILKLRPGGEQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNVIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQQDSGNV
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNSTLFPHQKKCSHMKVGDTASFNVTV
SVANCEKRSQHIVIKPVGLGDTLEILISPQCSCDCQQEVEVNSSKCHDGNGSFQCGVCAC
HPGHMGPRCECGEDMLSTDSCREAPGQPSCSGRGDCYCGQCVCHLSPYGNIYGPFCQCDN
FSCVRHKGLLCGDNGECACGECVCRSGWTGEYCNCTTSTDACVSHDGVLCSGRGDCVCGR
CVCTNSGASGPTCERCPTCGDPCNSKRSCIECHLSADGQAQEECVDKCKLVGATISEEDF
SKDGSVSCSLQGENECLITFLITTDNEGRSIIHSISETDCPKPPNIPMIMLGVSLAILLI
GVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKV
DFSTDG
Download sequence
Identical sequences G1T891
ENSOCUP00000012771 9986.ENSOCUP00000012771 ENSOCUP00000012771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]