SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012953 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012953
Domain Number 1 Region: 173-281
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.19e-35
Family Frataxin-like 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012953   Gene: ENSOCUG00000015076   Transcript: ENSOCUT00000015072
Sequence length 300
Comment pep:known_by_projection chromosome:OryCun2.0:1:55340294:55372444:1 gene:ENSOCUG00000015076 transcript:ENSOCUT00000015072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQASTMGLLFPRAAQLRAGSSVFAQGQAGISEKELGYLSLWGAMEAFPCLLSRRRDPSTR
GGHQVSPQRARAGGRSWPKIRSSMWTLGAARSRASGPGRRPPESAHARVGAPRPADTARL
CCLRGLRPGTAVACAPAPASFTVQCLSPLLRVKKQKVCLMTLRTSGESGDPGSLDETTYE
RLAEETLDSLAEFFEDLADKPYTLKDYDVSFGSGVLTIHLGGDLGTYVINKQTPNKQIWL
SSPSSGPKRYDWTGKNWVYSHDGVSLHQLLATELTEALKTKLDLSSLAYSGKDRCCPATC
Download sequence
Identical sequences G1T8N8
ENSOCUP00000012953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]