SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012956 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012956
Domain Number 1 Region: 478-967
Classification Level Classification E-value
Superfamily ALDH-like 1.68e-131
Family ALDH-like 0.00000000521
Further Details:      
 
Domain Number 2 Region: 65-265
Classification Level Classification E-value
Superfamily Formyltransferase 3.4e-52
Family Formyltransferase 0.00000000299
Further Details:      
 
Domain Number 3 Region: 269-370
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.35e-26
Family Post formyltransferase domain 0.00000193
Further Details:      
 
Domain Number 4 Region: 388-474
Classification Level Classification E-value
Superfamily ACP-like 0.00000331
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012956   Gene: ENSOCUG00000015071   Transcript: ENSOCUT00000015076
Sequence length 968
Comment pep:known_by_projection chromosome:OryCun2.0:9:5584309:5712102:-1 gene:ENSOCUG00000015071 transcript:ENSOCUT00000015076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLESHRSQTNTGANESLPHDPEESVHGIWAPITAASAFPQCIRFLGQARSERLLRCLGLP
TPAAMKIAVIGQSLFGQEVYCHLRKDGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKF
PRWRARGQVLPEVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGA
SAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQRECEVLPDDTVSTLYNRFLFPEGIKGM
VQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAQINWDQPAEAIHNWIRGNDKVPGAWTE
ACGQKLTFFNSTLTVPGSVPEGDPLPIPGAHRPGLVTKAGLILFGNDDKMLLVKNIQLED
GKMIPAAQFFKGAASSALELTEEELATAEAVRSTWQRILPNIPEVEDTTDFFKSGAASVD
VVRLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGEDAEGECVIDYVEKAVNKL
TLRMPHQLFIGGAFVDAEGSKTYDTINPTDESVICQVSLAQASDVDKAVAAAKDAFENGL
WGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGW
CDKIQGSTIPINHARPNRNLTLTRKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVI
KPAQVTPLTALKFAELTLRAGIPKGVVNVLPGSGRPQDSGSSSGSRPSRPSMAPWAFQGP
WVGPLVVVNSSLILMNQDLLALGWHLMIFEECSIHDCVQMGMSSVFFNKGENCIAAGRLF
VEDSIHDQFVQRVVEEVGKMKIGDPLDRATNHGPQNHQAHLRKLLEYCQRGVQEGATLVC
GGGQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDIDAVLCRANATEFGL
ASGVFTKDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLR
IKTVTFEY
Download sequence
Identical sequences G1T8P1
ENSOCUP00000012956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]