SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013032 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013032
Domain Number 1 Region: 20-238
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-76
Family Phosphate binding protein-like 0.00000403
Further Details:      
 
Domain Number 2 Region: 240-302,332-354
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 3.01e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013032   Gene: ENSOCUG00000015161   Transcript: ENSOCUT00000015162
Sequence length 362
Comment pep:known_by_projection scaffold:OryCun2.0:GL018823:559535:565977:1 gene:ENSOCUG00000015161 transcript:ENSOCUT00000015162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGNGNDEASATTEASSPRMRVIRVGTRKSQLARIQTDSVVATLKTLYPGLRFEIIAMSTT
GDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTVGAICKRENP
CDAVVFHPKFVGKTLATLPERSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDE
QQEFSAIILAVAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLH
DPETLLRCIAERAFLKHLEGGCSVPVAVHTAMKDGQLYMTGGVWSLDGSDTMQETMQASI
QVPAQHEDGPEDDPQLVGITARNIPRGPQLAAENLGISLANLLLNKGAKNILDVARQLND
AH
Download sequence
Identical sequences G1T8V6
ENSOCUP00000013032 9986.ENSOCUP00000013032 ENSOCUP00000013032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]