SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013068 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013068
Domain Number 1 Region: 102-261
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.02e-34
Family Eukaryotic ODC-like 0.0000138
Further Details:      
 
Domain Number 2 Region: 3-134
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.21e-27
Family Alanine racemase-like, N-terminal domain 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013068   Gene: ENSOCUG00000015196   Transcript: ENSOCUT00000015207
Sequence length 264
Comment pep:known_by_projection chromosome:OryCun2.0:3:118282867:118295280:-1 gene:ENSOCUG00000015196 transcript:ENSOCUT00000015207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLRVLLHIATEDYIGGEEGNMKFGTSLKNCRHLLECAKELDVQIIGVKFHVSSACKESQ
VYVHALSDARCVFDMAGEFGYTMNMLDIGGGFTGTEFQLEEVNHVISPLLDVYFPEGSGI
KIISEPGSYYVSSAFTLAVNIIAKKVVENGKLSSGEKTGSDEPAFVYYMNDGVYGSFASK
LSENLNAIPEVHKKCKEDEPLFTSSLWGPSCDELDLIVENCLLPELNVGDWLIFDNMGAD
SFHEPSAFNDFQRPAVYYMMSFSD
Download sequence
Identical sequences G1T8Y4
9986.ENSOCUP00000013068 ENSOCUP00000013068 ENSOCUP00000013068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]