SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013164 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013164
Domain Number 1 Region: 78-594
Classification Level Classification E-value
Superfamily ALDH-like 1.26e-120
Family ALDH-like 0.000000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013164   Gene: ENSOCUG00000015315   Transcript: ENSOCUT00000015321
Sequence length 610
Comment pep:known_by_projection chromosome:OryCun2.0:13:133985549:134011065:1 gene:ENSOCUG00000015315 transcript:ENSOCUT00000015321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGAGISGVPFPPFSPGGVRFPAGGPVVWQLPRGAPRGKTGPGAGECCSPPPPLRRALL
ARPWRGAGLWWKHASSLHVANEPILAFTRGSPEREALQKALTALKNQTEAIPCVVGHEEV
WTSDIRYQLSPFNHRHKVAKFCYADKALLNKAIEASLAARKEWDLKPVADRAQIFLKAAD
MLSGPRRADILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAMELAGQQPISLPPSTN
SVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYCVLREAG
LPPNIIQFVPADGPVFGDTVTSSEHLCGINFTGSVPTFRHLWKQVAQNLDRFRTFPRLAG
ECGGKNFHLVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPSSLWPQIKGRLLEEHS
RIKVGDPAEDFGTFFSAVIDAKSFGRIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCI
VESKDPQDPIMKEEIFGPVLTVYVYPDNKYKETLQLVDSTTSYGLTGAVFAQDKDVIQEA
TEMLRHAAGNFYINDKSTGSVVGQQPFGGSRASGTNDKPGGPHYILRWTSPQVIKETHKP
LGDWRYAYMQ
Download sequence
Identical sequences G1T970
ENSOCUP00000013164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]