SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013369 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013369
Domain Number 1 Region: 217-497
Classification Level Classification E-value
Superfamily TPR-like 9.76e-32
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000013369
Domain Number - Region: 9-51
Classification Level Classification E-value
Superfamily TPR-like 0.00275
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Domain Number - Region: 159-221
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0462
Family Phosphate binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013369   Gene: ENSOCUG00000015555   Transcript: ENSOCUT00000015556
Sequence length 505
Comment pep:known_by_projection chromosome:OryCun2.0:20:16549898:16607638:-1 gene:ENSOCUG00000015555 transcript:ENSOCUT00000015556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEMEPLLLAWSYFRRRKFQLCADLCTQVLEKSPYDQAAWILKARALTEMVYVDEVDVD
QEGIAEMILDENAIAQVPRPGTSLKLPGTSQSGGPSQAVRPVTQAGRPITGYLRPSTQSG
RPGTMEQAIKAPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPK
LAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKS
ALKQQEMVDTFLYLAKVYIALDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNISS
ATEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGVYNCQLFNNLGLCC
FYAQQYDMTLTSFERALSLAENEEETADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNHH
AEAYNNLAVLEMRQGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYAAAQK
SEAAFPDHVDTQHLIKQLKQHFAML
Download sequence
Identical sequences G1T9Q2
ENSOCUP00000013369 XP_002719656.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]