SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013843 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013843
Domain Number 1 Region: 513-705
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.14e-56
Family Hemopexin-like domain 0.000000025
Further Details:      
 
Domain Number 2 Region: 109-217,393-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.62e-47
Family Matrix metalloproteases, catalytic domain 0.000000456
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-21
Family Fibronectin type II module 0.0001
Further Details:      
 
Domain Number 4 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 2.43e-20
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 5 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 8.95e-18
Family MMP N-terminal domain 0.0000753
Further Details:      
 
Domain Number 6 Region: 335-383
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-16
Family Fibronectin type II module 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013843   Gene: ENSOCUG00000016101   Transcript: ENSOCUT00000016107
Sequence length 706
Comment pep:known scaffold:OryCun2.0:GL018725:971854:979002:1 gene:ENSOCUG00000016101 transcript:ENSOCUT00000016107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRQPLVLALLVLGCCSAAPRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASM
HGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRS
YTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYS
ACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSS
CTSEGRRDGRLWCATTSNFDSDRNGVPGLRGWGLFLVAAHEFGHALGLDHSSVPEALMYP
MYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEHP
TTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYWR
FSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRRL
DKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLNT
HDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPED
Download sequence
Identical sequences G1TAX1
ENSOCUP00000013843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]