SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013913 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013913
Domain Number 1 Region: 348-614
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-88
Family Eukaryotic proteases 0.00000000393
Further Details:      
 
Domain Number 2 Region: 105-193
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-31
Family Kringle modules 0.0000145
Further Details:      
 
Domain Number 3 Region: 204-296
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-27
Family Kringle modules 0.0000319
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 6.73e-19
Family GLA-domain 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013913   Gene: ENSOCUG00000016180   Transcript: ENSOCUT00000016185
Sequence length 617
Comment pep:known_by_projection chromosome:OryCun2.0:1:186084682:186102084:1 gene:ENSOCUG00000016180 transcript:ENSOCUT00000016185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHVPGLRLAGCLAAAALVSLVCSQQVFLAPQRAMSLLQRARRANTGFLEEMRKGNLERE
CYEEVCSYEEAFEALESSSATEAFWAKYTACEPVRTPRENFTNCMEGHCAQGLGTNYRGQ
VSVTQSGIECQLWRSRYPHNPEINFTTHPEADLKENFCRNPDGSTTGPWCYTRDPSVRRE
ECSVPDCSQGQVTLELRPRTGHSGVTQPPPLEPCVSERGRHYQGRLAVTKQGTPCLAWSS
PEAQALSRGKSFSPQVPLVENFCRNPDGDEEGAWCYVAGRPSSFEYCGLNYCEEAIEEEV
LGLEEAIEGRTTEQEFQTFFNQETFGTGEADCGLRPLFEKKSLKDEREEELLESYIHGRI
VGGRDAQIGSAPWQVMIFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVNDILV
RIGKYARSRYERNMEKISTLEKIIIHPGYNWRENLDRDIALMKLKKPVAFSDYIHPVCLP
DKQIVTSLLQAGHKGRVTGWGNLKEMWTVNMNEVQPSVLQMVNLPLVERPICKASTRIRV
TDNMFCAGYKPEEGKRGDACEGDSGGPFVMKNPYNNRWYQMGIVSWGEGCDRDGKYGFYT
HVFRLKKWIRKMVDRFG
Download sequence
Identical sequences G1TB36
ENSOCUP00000013913 ENSOCUP00000013913 9986.ENSOCUP00000013913 XP_002709128.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]