SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014056 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014056
Domain Number 1 Region: 218-381,414-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-38
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 481-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-21
Family Flavin-binding PAS domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014056   Gene: ENSOCUG00000016348   Transcript: ENSOCUT00000016352
Sequence length 1108
Comment pep:known_by_projection chromosome:OryCun2.0:14:5178720:5625586:1 gene:ENSOCUG00000016348 transcript:ENSOCUT00000016352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKSEFKGEIIFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEEKKEDKAKGRSRAGTHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTVVLTLLM
SVFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVITRLSNKSTVPQSEPKGNGSIKKRLPSIVEDEEEEEDGE
EEETASLSPIYTRGSSSSRSKKIGSNKSYLGLSLKQLASGTVPFHSPIRVSSSNSPKAKQ
ETDPPNHGKRKEKNLKLQLSTLNSVGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIKPE
LRISPPIGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMKSVMQLLENVL
SPQQPSQLCSLHTTAVCPSRESLQTRMSWSTHQPCLHLQTAGAAYTQAQLCGSNVTSDIW
GVDPSSLGSSPQRTGAREQHPADSELCHSPNIDYSPSHYQVVQEGHLQFLRCISPHSDTT
LTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFIQGAVSSLSLENLPGSWDRERMAS
VSTKPLENFPLEVVTSTAETKDNKAINV
Download sequence
Identical sequences G1TBG1
ENSOCUP00000014056 ENSOCUP00000020113 9986.ENSOCUP00000014056 XP_002716246.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]