SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014226 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014226
Domain Number 1 Region: 411-713
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-71
Family Protein kinases, catalytic subunit 0.000000497
Further Details:      
 
Domain Number 2 Region: 282-370
Classification Level Classification E-value
Superfamily Kringle-like 1.11e-34
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 36-124
Classification Level Classification E-value
Superfamily Immunoglobulin 8.58e-22
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014226
Domain Number - Region: 142-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00602
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014226   Gene: ENSOCUG00000016548   Transcript: ENSOCUT00000016551
Sequence length 911
Comment pep:known_by_projection chromosome:OryCun2.0:1:76418866:76467071:1 gene:ENSOCUG00000016548 transcript:ENSOCUT00000016551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEVEVPDPIDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPN
VRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLYV
RLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTM
IGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLESDLCRREYTVAR
SNPLILMRLQLPKCELLPLPDSPDAANCMRIGIPAERLGRYHQCYNGSGADYRGTASTTK
SGHQCQPWALQHPHSHHLSSADFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVP
SCSPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASGSAPQRRQLMASPSQDM
EMPLISQHKQAKLKEISLSTVRFMEELGEDRFGKVYKGHLFGPTPGEQTQAVAIKTLKDK
AEGPLREEFRHEAMLRARLQHPNVICLLGVVTKDQPLSMIFSYCPHGDLHEFLVMRSPHS
DVGSTDDDRTVKSALEPPDFVHVVAQIAAGMEFLSSHHVVHKDLATRNVLVYDKLAVKIS
DLGLFREVYAADYYKLMGSSLLPIRWMSPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQP
YCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWHEFPSRRPRFKDIHSRLRAWGNL
SNYNSSAQTSGASNTTQTSSLSTSPVSNVSNTRYVGPKQKAQPFPQPQFIPMKGQIRPMV
PAPQLYIPVNGYQPVPAYGAYLPNFYPVHIPMQTAPQQVPPPMVPKPSSHHSGSGSTSTG
YVTTAPSNTSVADRAALLSEGTEDTQNVPEDVAQSPVQEAEEEEEGSVPETELLGDNDTL
QMEEAQVQLEA
Download sequence
Identical sequences G1TBV9
9986.ENSOCUP00000014226 ENSOCUP00000019431 ENSOCUP00000014226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]