SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014386 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014386
Domain Number 1 Region: 575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-50
Family Phosphate binding protein-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.34e-23
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014386
Domain Number - Region: 676-769
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0549
Family Voltage-gated potassium channels 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014386   Gene: ENSOCUG00000016738   Transcript: ENSOCUT00000016736
Sequence length 1115
Comment pep:known_by_projection chromosome:OryCun2.0:1:11180155:11399487:1 gene:ENSOCUG00000016738 transcript:ENSOCUT00000016736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPLPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APSATSRAPDGSRAGAQRDEPEPGTWRPPAPSPGARWLGSALHGRGRLGARKPGEGAGAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LSSTKDLVSFLQVQLESVKNSTPTIVMFGCDMESIRQIFEITTQFVVTPSELHWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
DVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLNPMTNDSSILDSLFNSLHSSNDTVPIKFKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLSGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSFSSAL
NVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEFLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKMVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRALNTSFGEEKQQRFKTKRVEKRSNVAPRQLMVWNTSSLS
HDNQRKYIFSDEGGQNQLGIRTPQDIPLPPRRRELPASLTTNGKADSVNVARNSVMQELS
ELEKQIRVIRQELQLAVSRKTELEEYQRTNRTCES
Download sequence
Identical sequences G1TC94
XP_002708192.1.1745 ENSOCUP00000014386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]