SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014488 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014488
Domain Number 1 Region: 41-196
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.08e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 201-368
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.14e-37
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014488   Gene: ENSOCUG00000016862   Transcript: ENSOCUT00000016858
Sequence length 451
Comment pep:known_by_projection chromosome:OryCun2.0:13:11519669:11532132:1 gene:ENSOCUG00000016862 transcript:ENSOCUT00000016858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMLLLARCLLVVLVSSLLMCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSD
FLTFLDRDDSARKVFYVIETLEPRERLLLTAAHLLFVAPHNASAAGEPELAPGAGPPPGG
APGRRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEATGAYAPLTAQGTILIN
RVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDPAAPGAADAPGAPGPAG
IHWYSQLLYQIGTWLLDSEALHPLGMASQSS
Download sequence
Identical sequences G1TCI1
XP_002715068.1.1745 ENSOCUP00000014488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]