SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014561 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014561
Domain Number 1 Region: 28-510
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-183
Family ALDH-like 0.0000000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014561   Gene: ENSOCUG00000016942   Transcript: ENSOCUT00000016946
Sequence length 590
Comment pep:known_by_projection chromosome:OryCun2.0:17:14307106:14434356:1 gene:ENSOCUG00000016942 transcript:ENSOCUT00000016946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTDPALRNTKLSHSPDLKMEMITCRPGRYRTT
RANQLGMVSWHSVRGHPNDTKHGGKWGQGQTQMPGALGRSKYLLLEQGMG
Download sequence
Identical sequences G1TCP3
ENSOCUP00000014561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]