SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014599 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014599
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.26e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014599   Gene: ENSOCUG00000016995   Transcript: ENSOCUT00000016991
Sequence length 228
Comment pep:novel chromosome:OryCun2.0:7:150827415:150845082:1 gene:ENSOCUG00000016995 transcript:ENSOCUT00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMKSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences G1TCS3
XP_002712491.1.1745 ENSOCUP00000014599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]