SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015030 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015030
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.01e-52
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015030   Gene: ENSOCUG00000017498   Transcript: ENSOCUT00000017494
Sequence length 196
Comment pep:known_by_projection chromosome:OryCun2.0:3:12619798:12641686:1 gene:ENSOCUG00000017498 transcript:ENSOCUT00000017494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPK
GLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALE
LVGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQ
NLIKASAPESGLLSKV
Download sequence
Identical sequences G1TDT6
ENSOCUP00000015030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]