SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015160 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015160
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 4.45e-43
Family Nip7p homolog, N-terminal domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.05e-26
Family PUA domain 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015160   Gene: ENSOCUG00000017652   Transcript: ENSOCUT00000017652
Sequence length 180
Comment pep:known_by_projection chromosome:OryCun2.0:5:24738106:24739877:1 gene:ENSOCUG00000017652 transcript:ENSOCUT00000017652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKMAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTAQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADVGEYVRHEETLT
Download sequence
Identical sequences G1TE50
ENSOCUP00000015160 ENSOCUP00000015160 9986.ENSOCUP00000015160 XP_002711775.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]