SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015240 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015240
Domain Number 1 Region: 183-284
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.58e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 37-144
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.44e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015240   Gene: ENSOCUG00000017741   Transcript: ENSOCUT00000017744
Sequence length 760
Comment pep:known chromosome:OryCun2.0:20:9365898:9390633:1 gene:ENSOCUG00000017741 transcript:ENSOCUT00000017744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTEC
VLKPVESSDMKMTQLFTKVESADTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDSE
TDDQQLEEVPLYNDVMFPSSNEKLQDINLAMSPLPASESPKPLRSSADPALNQEVALKLE
PNPESLELSFTMPQIQDQPASPSDGSTRQSSPEPTSPSEYCFDVDSDMVNVFKLELVEKL
FAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSAGAVTVFPQTQG
QEPAANTATATATTDELKPVTKDSVEDMKVLIASPSPNHIPKETASATTSPPYRDTPSRT
ASPNTAGKGVIEQTEKSHPRSPNVLAVTLSQRTTVPEEELNPKILALQNAQRKRKMESDG
SLFQAVGIGTLLQQPDDRTTTASLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQS
MDESGLPQLTSYDCEVNAPVQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences G1TEC3
ENSOCUP00000015240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]