SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015877 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015877
Domain Number 1 Region: 73-117
Classification Level Classification E-value
Superfamily LysM domain 0.000000000811
Family LysM domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015877   Gene: ENSOCUG00000025598   Transcript: ENSOCUT00000031575
Sequence length 216
Comment pep:known_by_projection chromosome:OryCun2.0:17:20800307:20821281:1 gene:ENSOCUG00000025598 transcript:ENSOCUT00000031575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASRSPCEARRPGGPGRIHGGSHARAVPASRSGSESEEAELSLSLARTKTRSYGSTASVR
APLGAGVLERRVEHRVRAGDTLQGIALKYGVTMEQIKRANNLFTNDCIFLKKTLSIPIIS
EKPLAFNGLNSIDSPENETVDSSFAQEELPVRAGEDLPPPSPQEPDVQPGQPEEVTARDF
LQRLDQQIKLSTQAAKKLKGESRDEESPYATSLYHS
Download sequence
Identical sequences G1TG29
9986.ENSOCUP00000015877 ENSOCUP00000015877 ENSOCUP00000015877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]