SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016099 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016099
Domain Number 1 Region: 36-486
Classification Level Classification E-value
Superfamily ALDH-like 8.38e-75
Family ALDH-like 0.0000000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016099   Gene: ENSOCUG00000023726   Transcript: ENSOCUT00000030162
Sequence length 492
Comment pep:known_by_projection chromosome:OryCun2.0:1:15772941:15776417:-1 gene:ENSOCUG00000023726 transcript:ENSOCUT00000030162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKTSLVMGGRGPAGQIRLARPTAPSSSLSLPSPSQHPHVHYTQVFVHSKWQDTVSKKTF
PTVTPTAEVLGCVAEGNQAGRAAHEAFCLGSPWRRVGASAQGRLLSRLPNAVEWDCVLLA
SLDNSKPSQDQYTLAQASLHCRTIPMDGRHALCPTWPEPARVCGQITLWNWLEAYLGAGC
RLHPACEVAEQTVLSTLHLVSLIKEAGFPSGVVNTITGQGPRAGAAGAQHSDIGNVAFMG
SMEVGHLSRKAASDSSLKRVTLELGGKSPSVVLAHADLGRAVARCHGATFFNMGQCCSAG
SRTFAGKSIYDEFPERAMGKTKQRKVGNPPPEPQVDRQQVEQVLGCIWPGQEEGKLVRGG
EHFGARGFFIKPTVSGSMQGDMGIVTEISEPPQSLFRKVEEVIERTSSARCGLAAAVLTR
DRTSSARCGSAAAVFTQDLQAGTAWVNTCNVVSCREPFGFKESGSGSELGEDGLQAYTEV
RTVPVKVPQKNS
Download sequence
Identical sequences G1TGP9
ENSOCUP00000016099 ENSOCUP00000016099 9986.ENSOCUP00000016099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]