SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016165 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016165
Domain Number 1 Region: 64-263,308-469
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.85e-79
Family YicI catalytic domain-like 0.00046
Further Details:      
 
Domain Number 2 Region: 4-61
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000973
Family YicI N-terminal domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 472-506
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000187
Family Putative glucosidase YicI, domain 3 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016165   Gene: ENSOCUG00000027354   Transcript: ENSOCUT00000023682
Sequence length 506
Comment pep:novel scaffold:OryCun2.0:GL018758:880313:891781:1 gene:ENSOCUG00000027354 transcript:ENSOCUT00000023682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKMNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGVLDFYVFLGPT
PELVTQQYTEVIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDDMVAAQIPYDVQYSDID
YMERQLDFTLSPKFAGLPALIQRLHGDGMRVILILDPAISGNETQPYPAFTRGVEDDVFI
KYPNGGGIVWGKVWPDYPGVVVNSSLDWDSQVEQYRAYAAFPDFFRNSTVSWWKREIQEM
YTNPQNPEKSLKFDGLWIDMNEPASFVNGAVPAGCTDSTLNHPPYMPHLESRGTGLNSKT
LCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGG
HWLGDNTAAWDQLRKSIIGMMEFSLFGIPYTGADICGFFQDAEYEMCARWMQLGAFYPFS
RNHNTEGTKRQDPVSWNATFVNLSRSVLETRYTLLPYLYTLMYKAHVEGSTVVRPLLHEF
VSDRVTWDIDGQFLLGPAFLVSPVLE
Download sequence
Identical sequences G1TGW3
9986.ENSOCUP00000016165 ENSOCUP00000016165 ENSOCUP00000016165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]