SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016198 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016198
Domain Number 1 Region: 247-430
Classification Level Classification E-value
Superfamily vWA-like 0.00000000779
Family Trunk domain of Sec23/24 0.052
Further Details:      
 
Domain Number 2 Region: 735-843
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016198   Gene: ENSOCUG00000015532   Transcript: ENSOCUT00000023660
Sequence length 1295
Comment pep:known_by_projection chromosome:OryCun2.0:13:101736627:101975482:-1 gene:ENSOCUG00000015532 transcript:ENSOCUT00000023660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREPEEPEDEETAGAAVLAQRCPGSPGWAGAGAGARRPPLWLLCLVACWLLGAVADADF
SILDEAQVLASQMRRLAAEELGVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRY
LDVVNRNKQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTV
NSRAFNPGRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYV
STVRPQSKHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADTVRTCSLD
QCYKTFLSPATSETKRKMSTFVSSIKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDL
AIVYLSAGITSKDSSEEDKKATLRVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRD
LAEQNSGKYGVPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSD
EMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMH
PSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLR
ETGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTIPSSKLLYHRLDLLGQPS
ACLHFKQLATLESPTVMLAAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKF
SVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQW
YLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYK
VLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDIL
NHPNFVKKNLCNSFSDRTVQRFYKFNTSLVGDLTNLVHGSHCSKYRLARIPGTNAFVGIV
NETCDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVH
QEPVTYTAIDPGLQDALHQCVNSRCSQRMESGDCFGVLDCEWCMVGSDGKTHLDKSYCAP
QKECFGGIVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRH
QIHRRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVIERHAHSP
ERRRRYWGRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHDEDLDLDTPPQTAA
LLSHKFHHYRPHHPPLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences G1TGZ6
XP_002715991.1.1745 ENSOCUP00000016198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]