SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016794 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016794
Domain Number 1 Region: 179-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.53e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 5-57
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000499
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016794   Gene: ENSOCUG00000010632   Transcript: ENSOCUT00000029233
Sequence length 773
Comment pep:known_by_projection chromosome:OryCun2.0:17:53351373:53594646:1 gene:ENSOCUG00000010632 transcript:ENSOCUT00000029233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMK
LPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTK
RGVHIKSSGYKVIHVTGRLRLRVSLSHGRTVPSQIMGLVVVAHALPPPTINEVRIDCHMF
VTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVT
KYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPE
KTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDNDMNC
NDDGHSSSNPDSRDSDDSFEHSDFENPKAAEDGFGALGPMHIKVERYVESESDLRLQNCE
SLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSASRRRLSSASSPGGLDAGLVEP
PRLLSSPHSASVLKIKTEISEPINFDNDSSIWNYPPNREICRNESPYSMTKPPSSEHFPS
PPGGGGGGGGGGGLHVAIPDSVLTPPGADGAAARKTQFGASAAAALAPVASDPLSPPLSA
SPRDKHPGGGGGGGGGGPSASNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAA
QRVYTTGTIRYAPAEVTLAMQGNLLPNAHAVNFVDVNSPGFGLDPKTPVEMLYHHVHRLN
MSGPFGGAGGAASLTQMPGGNVFTTAEGLFSTLPFPVYSNGIHAAQTLERKED
Download sequence
Identical sequences G1TIM3
ENSOCUP00000016794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]