SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017172 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017172
Domain Number 1 Region: 404-576,605-666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.27e-44
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Domain Number 2 Region: 670-855
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 38-120
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000227
Family Flavin-binding PAS domain 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017172   Gene: ENSOCUG00000027575   Transcript: ENSOCUT00000021618
Sequence length 1159
Comment pep:known chromosome:OryCun2.0:13:12370887:12404072:-1 gene:ENSOCUG00000027575 transcript:ENSOCUT00000021618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDEPLFLCLNTFSPLSVETG
AVNCEEVHLEAVHSALLQGAEALDKYHWGPAGAWDAVSRAKTFRLKLPALLALTARESSV
RPGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVPAMDNHVAGLGPAEERRALVGSCSP
PPPVSAPGPHPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALPP
PPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREI
IAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLV
IYTAVFTPYSAAFLLKETEEGPPAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNA
NEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVGRK
LDRYSEYGAAVLLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNS
SGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNV
SAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKG
FPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTAL
YFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLL
EVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAEWEGGHRQRKRKLFFRKRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEQPGGEPLTEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPAP
SLLNIPLSSPSRRPRGDVESRLDALQRQLNRLETRLSTDMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPIPTLTLDSLSQVSQFMACEELPPGAPELPQDGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences G1TJP3
ENSOCUP00000017172 9986.ENSOCUP00000017172 ENSOCUP00000017172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]