SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017231 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017231
Domain Number 1 Region: 17-276
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.89e-66
Family Carbonic anhydrase 0.0000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017231   Gene: ENSOCUG00000026525   Transcript: ENSOCUT00000028785
Sequence length 280
Comment pep:known_by_projection chromosome:OryCun2.0:3:75800803:75899631:-1 gene:ENSOCUG00000026525 transcript:ENSOCUT00000028785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDSVAFRVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSP
NYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVN
FKAFPMEVHLIWSFSLFCNLNEIVGENQHVIPIKILLIYLGRNHTALELLSNVKQNLYIP
GGKSKTIPCFNPNTLLPGDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEF
RRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences G1TJV1
ENSOCUP00000017231 ENSOCUP00000017231 9986.ENSOCUP00000017231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]