SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017448 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017448
Domain Number 1 Region: 9-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 6.08e-46
Family Isochorismatase-like hydrolases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017448   Gene: ENSOCUG00000020977   Transcript: ENSOCUT00000023678
Sequence length 221
Comment pep:known_by_projection scaffold:OryCun2.0:GL019905:270:7974:-1 gene:ENSOCUG00000020977 transcript:ENSOCUT00000023678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPGLGRVHPGSSILFLCDMQEKFRHGIAYFPQIVSVAARMLRVARLLGVPAVLTEQ
YPQGLGPTVPELGAEGLQPLSKTCFSMVPAARQELDSRPQLQSVLLCGIEAQACILRPCS
PPGLALTLLCPQNTALDLLDRGLQVHVVADACSSRSQVDRLVALARMRQSGAFLCSSEGL
ILQLVGDAAHPQFKEIQKIIKEPAPDSGLLGLFQGQNPLFS
Download sequence
Identical sequences G1TKG2
ENSOCUP00000017448 ENSOCUP00000017448 9986.ENSOCUP00000017448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]