SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017620 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017620
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 8.72e-18
Family DNA polymerase processivity factor 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017620   Gene: ENSOCUG00000024015   Transcript: ENSOCUT00000027984
Sequence length 393
Comment pep:known_by_projection chromosome:OryCun2.0:1:194830313:194837468:1 gene:ENSOCUG00000024015 transcript:ENSOCUT00000027984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLVTGGNVKVLGKAVHSLSRIGDELYLEPMEEGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDPLHCKILMKSFLSVFRSLAMLEKTVETCCISLSGRSSRLVVQLHCRYGVRK
THNLAFQDCESLQAVFDPASCPYKLCAPARVLGEAVLPFPLALAEVTLGVGAGRRVILRS
YQEDEADSSLKAMVTEMSLGEDDFQQLRVREGVAVTFCLKEFRGLLSFAESVNLSLSVHF
DTPGRPAIFTVEDSTLDGHFVLATLSEPDPHSLGLGSLEPRRPEPRLQAHSTPHQDDFAS
DDMDSYMITMETSGGSEAPWARPSGSPSPGPQPPCSPAPPSEDEDEDEAEPTTVPGTPPP
KKFRSLFFGSVLTPMRSPQGPSSVLAEDSDGEG
Download sequence
Identical sequences G1TKX6
XP_002709285.1.1745 ENSOCUP00000017620 ENSOCUP00000017620 9986.ENSOCUP00000017620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]