SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017774 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017774
Domain Number 1 Region: 347-447
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 79-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.31e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 163-217,245-264
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017774   Gene: ENSOCUG00000005940   Transcript: ENSOCUT00000027080
Sequence length 632
Comment pep:known_by_projection chromosome:OryCun2.0:1:155134370:155170679:1 gene:ENSOCUG00000005940 transcript:ENSOCUT00000027080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPPDLLSSSLGSSSVDCNRKRKGSSTDYQLDDFSFEESMDTD
KDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDIT
PGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPP
TKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFV
DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVLASVLEGGDPAFPQLTASPHSVDSVLPSGEGG
PKRTHPTVPGIPGGTRAGAGKGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASS
PGGKKILNGGTPDIPSSGLLPGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPS
NDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences G1TLC5
9986.ENSOCUP00000017774 ENSOCUP00000017774 ENSOCUP00000005145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]