SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018127 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018127
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-28
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 2 Region: 168-317
Classification Level Classification E-value
Superfamily TPR-like 1.37e-21
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018127   Gene: ENSOCUG00000026157   Transcript: ENSOCUT00000030857
Sequence length 327
Comment pep:known_by_projection scaffold:OryCun2.0:GL018765:1115460:1141436:-1 gene:ENSOCUG00000026157 transcript:ENSOCUT00000030857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFARPRNGMAPSGEDCLSVYQRLSQRMLDISGDRGVLKDVIREGVGELVTPDASVLVK
YSGYLEHMDKPFDSNCFRKSPRLMKLGEDITLWGMELGLLSMRRGELARFLFTPTYAYGA
LGCPPLIPPNTTVLFEIELLDFLDSAESDTFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFCDAKARYKRALLLLHRRSAAPGEQHLVEAAKLLVLLNLSFTYLKLERPAPALC
YGEQALDIDNKNTKALFRCGQACLLMTEYEKARDFLVRAQKQQPFNHDINSELKKLASCY
KDYTDREREMCHRMFAPCADGPAMAQH
Download sequence
Identical sequences G1TMB9
9986.ENSOCUP00000018127 ENSOCUP00000018127 ENSOCUP00000018127 XP_002722023.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]