SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018240 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018240
Domain Number 1 Region: 245-568
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.08e-65
Family Glutamine synthetase catalytic domain 0.00054
Further Details:      
 
Domain Number 2 Region: 135-241
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.2e-17
Family Glutamine synthetase, N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018240   Gene: ENSOCUG00000025847   Transcript: ENSOCUT00000027051
Sequence length 571
Comment pep:known chromosome:OryCun2.0:12:50062848:50102866:-1 gene:ENSOCUG00000025847 transcript:ENSOCUT00000027051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDEGDLLQEDTARDEVNETEASRMSKLRKTRKKVTKPHDYSTEVGEMDISNSNERIRSQ
MLCHQLGDTSKPVAGPSSSETRVSQDDKDSPDQTMVMKPLPPQTASVPSGEHNTNSDCTR
DSTQILTPPQLSSRMKHIKQEMAKNHLQFVQFEASDLHGVSRSKSIPAHFFQEKVIHGVF
MPRGYLELIPNPKDNEVNHIRATCFNNDIVLMPELSSFRVLPWAERTARVICDTFTVTGE
PLLTSPRYIAKRQLNQLQDCGFSLLSAFIYDFCIFGVPEIINSKTISFAASTLVNNHDQP
FMQELVDGLYHTGASVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVKEVARKYNY
IASFFIETGFCNSGILSHSLWDVDGKKNMFCNSSGVEQLTIIGKKWLAGLLKHSAALSCL
MAPAVSCRKRYSKETKDLKESVPTTWGYNDNSCAFNIKCHGDKGARIENKLGSATANPYL
VLAATVAAGLDGLQSNLDDLAGPDDSTDLFQSEPSEIPLKLEDALVALEEDECLREALGE
TFIRYFVAMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences G1TMM9
9986.ENSOCUP00000018240 ENSOCUP00000018240 ENSOCUP00000018240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]