SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018475 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018475
Domain Number 1 Region: 8-488
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-163
Family ALDH-like 0.000000000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018475   Gene: ENSOCUG00000009444   Transcript: ENSOCUT00000026662
Sequence length 493
Comment pep:known chromosome:OryCun2.0:1:59416689:59478488:-1 gene:ENSOCUG00000009444 transcript:ENSOCUT00000026662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLPTPLTNLKIQYTKIFINNEWHDSVSGKKFPVLNPATEEQICLIEEGDKADVDKAVK
AARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESLNAGKLFPNAYLMDLGG
CIKTLRYCAGWADKIQGRTMPMDGDFFCYTRHEPVGVCGQIIPWNFPLVMLIWKIGPALS
CGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFT
GSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLLNVVEFTYKNIFLNLGPCCYI
LFTERSLFSGNIHSTVINEGLYAVGNKFTPKMSTGPQIDKEQYNKILDLIESGKKEGAKL
ECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTTYGL
SAGIFTKDLDKAVTVSSALQAGTVWVNCYSVVSAQVPFGGFKMSGNGRELGEYGLQQYTE
VKTVTVKISQKNS
Download sequence
Identical sequences G1TNA5
ENSOCUP00000018475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]