SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019051 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019051
Domain Number 1 Region: 8-244
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.4e-68
Family Alanine racemase-like, N-terminal domain 0.000000283
Further Details:      
 
Domain Number 2 Region: 221-361
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.09e-35
Family Eukaryotic ODC-like 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019051   Gene: ENSOCUG00000020958   Transcript: ENSOCUT00000025270
Sequence length 366
Comment pep:novel scaffold:OryCun2.0:GL018704:6607494:6615483:-1 gene:ENSOCUG00000020958 transcript:ENSOCUT00000025270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDPFMVADLDVLARRHQTFCQALPGVLTFYSVKCNNSPWVLRVLAALGTGFDCASQVEME
QVLGLGVAPSRIIYANPCKSISHIQYAARHGVRLLTFDSEEELIKVAQHHPGARLVLRLW
TQDSQSIFPLSAKFGASLEACGHLLTSARDLGLAVVGVSFHVGSSCQTPTSYAQAITHCQ
QVFEMGRGAGHDMSLLDLGGGFPGAEGSQPLFEELVKGIKAALAQTFPEGSGVEVIAEPG
RFYAEPVFTAAVNIIAKKSVLEPGGRRKFVYYLNDGHYGSFRVFLREPAPRIPIVVKEFR
SEPPLFPCTLYGPTCDAFDRLFVAELQLPELDVGDWLVFPSMGAYTSSMSSTFNGFPPAT
LCYATS
Download sequence
Identical sequences G1TPW3
ENSOCUP00000019051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]