SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019369 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019369
Domain Number 1 Region: 8-235
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.4e-56
Family Inorganic pyrophosphatase 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019369   Gene: ENSOCUG00000027386   Transcript: ENSOCUT00000021759
Sequence length 237
Comment pep:novel chromosome:OryCun2.0:5:17131648:17132390:1 gene:ENSOCUG00000027386 transcript:ENSOCUT00000021759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTENVIGHHISPFHDIALKIDSKDNYFNMVVEVLWWTNAKMEVTTKEPLNSIKQDIKHG
KLLYVGNILPHKGYIRNYGVLSDLKDPVEQIRATSCCGDNDPNDVCEGSKVLTHAEVTHV
KILGILILDAGETDCIRVIDPEASRFDDIDDVKKLKPGDLGATLNWYVPDGKPENQFVVN
GEFRNKAFALEVIRSTHDGWIALLMKKCDGRPINSKNMQVFDSPFLCTQKEARSFIE
Download sequence
Identical sequences G1TQS3
ENSOCUP00000019369 ENSOCUP00000019369 9986.ENSOCUP00000019369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]