SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019475 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019475
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.27e-23
Family Ribosomal L11/L12e N-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.36e-18
Family Ribosomal protein L11, C-terminal domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019475   Gene: ENSOCUG00000020926   Transcript: ENSOCUT00000021969
Sequence length 192
Comment pep:known_by_projection chromosome:OryCun2.0:1:194078174:194080897:-1 gene:ENSOCUG00000020926 transcript:ENSOCUT00000021969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRVSRSLRKPEAGGVIRTIVRAGQAMSGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARRPGQEVAGLVTLKHVYEI
ALVKAKDDAFALLDVPLSSVVRSIIGSARSLGIRVVKDLSAEELAAFQKERAAFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences G1TR26
ENSOCUP00000019475 XP_002709298.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]