SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019562 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019562
Domain Number 1 Region: 48-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-39
Family Dual specificity phosphatase-like 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019562   Gene: ENSOCUG00000025317   Transcript: ENSOCUT00000028608
Sequence length 213
Comment pep:known_by_projection scaffold:OryCun2.0:GL019882:9618:18306:1 gene:ENSOCUG00000025317 transcript:ENSOCUT00000028608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAGGVRALDKHSWLLSGRASLVCEPSPLWRPLPAPGAAMARMNRPAPVELSYKNMRFL
ITHNPTNATLSTFIQDLKKYGATTVVRVCEVTYDKAPLEKDGITVVDWPFDDGAPPPGKV
VDDWLSLLKAKFCDDPGSCVAVHCVAGLGRAPVLVALALLESGMKYEDAVQFIRQKRRGA
INSKQLTYLEKYRPKQRLRFKDPRTHRTRCCVM
Download sequence
Identical sequences G1TRA7
ENSOCUP00000019562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]