SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019688 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000019688
Domain Number - Region: 2-91
Classification Level Classification E-value
Superfamily DNA clamp 0.0113
Family DNA polymerase processivity factor 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019688   Gene: ENSOCUG00000027263   Transcript: ENSOCUT00000022465
Sequence length 259
Comment pep:known_by_projection scaffold:OryCun2.0:GL018745:97543:107607:-1 gene:ENSOCUG00000027263 transcript:ENSOCUT00000022465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAKLAKTCALRISPDKLNFILSDKLAGGGASLWCELQQEDFFSEFQMEGVSADNNEIYL
ELTSENLARALKTAQNARALKVKLTNRHFPCLTVSVELISVSSSSRIVTHDIPIKVIPRR
LWRDFREPCIPDSDVSIYLPVLKTMRSVVEKMKNISNHLVIEANLNGELNLKIETELVCV
TTHFRDLGNPPLASENASQDRSPDQMAEVQIDIRKLLQLLAGQQVNPTRALCNIVHNRIV
HFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences G1TRN1
ENSOCUP00000019688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]