SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019705 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019705
Domain Number 1 Region: 114-281
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.32e-38
Family Ras-binding domain, RBD 0.018
Further Details:      
 
Domain Number 2 Region: 314-466
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.11e-31
Family PLC-like (P variant) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000019705
Domain Number - Region: 39-131
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0384
Family Eukaryotic type heme oxygenase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019705   Gene: ENSOCUG00000024764   Transcript: ENSOCUT00000030339
Sequence length 508
Comment pep:novel chromosome:OryCun2.0:13:95471030:95473871:1 gene:ENSOCUG00000024764 transcript:ENSOCUT00000030339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAMADILDIWAVDSWIASDGSIPVDFLLPTGIYIQLEVLREATISCIKQLWKPVHTYP
MFNLLMEIDSYMFACVNQAVVYEELEDETQRLCDVRSFLPVIKLVTGSCILVEKLDSDIG
VLIGKGLHEFDALKNPEVDEFRRKMYKFSEKKIQSLLTQTYPPEHDPSSLENSEDKVYGG
QLIVAVHFENSQDVFSFQVFPNMNPIKINELTIQKCLTIHKKEDEASLYEYVLQVSRGVE
YVFGDHPLIQFQYIQNCVMNRTLPRFILVECYKIKKMYEQEIIAIQAAINRNSSNPLLPL
PPKKTCIISHIALVKGNKLNTEETIKVVRTGLFHGFQLLCKTIVKNDRIWNEALEFDINT
CNLPRMAQLCFAVHAVLDKVKTKKSTKTINPSKYKIMRKVGNVHYPVASVNMKVFYFKGQ
LISGYTILHNWPSIPDELEEMLTPMGTVQTNPYTENVTALHIKFPENKKQSCYYPPFEKI
TDLSKNKKKKRLLKRQYLLQLGQVLRYE
Download sequence
Identical sequences G1TRP7
ENSOCUP00000019705 ENSOCUP00000019705 9986.ENSOCUP00000019705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]