SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019732 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019732
Domain Number 1 Region: 141-266
Classification Level Classification E-value
Superfamily FKBP-like 1.02e-39
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 2 Region: 41-156
Classification Level Classification E-value
Superfamily FKBP-like 1.32e-38
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 3 Region: 268-381
Classification Level Classification E-value
Superfamily FKBP-like 5.3e-37
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 4 Region: 375-480
Classification Level Classification E-value
Superfamily FKBP-like 1.3e-33
Family FKBP immunophilin/proline isomerase 0.00036
Further Details:      
 
Domain Number 5 Region: 486-561
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000251
Family Calbindin D9K 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019732   Gene: ENSOCUG00000010668   Transcript: ENSOCUT00000021958
Sequence length 572
Comment pep:known_by_projection chromosome:OryCun2.0:10:16787182:16833138:1 gene:ENSOCUG00000010668 transcript:ENSOCUT00000021958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALTAQRSGVPRPPPLLLLLLWVTGQAAPVAGLGSDAELHIERRFVPDECPRTVRSGDFVR
YHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVKIPPKLAYG
SEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFL
DGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEEGDGKDI
PGQASLVFDVALLDLHNPKDSISIENKVVPENCERRSQSGDFLRYHYNGTLLDGTFFDSS
YSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFD
IHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNI
VLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDVELLELVA
GLPEGYMFIWNGEVSPNLFEEIDKDGNGEVVLEEFSEYIHAQVASGKGKLAPGFDADMIV
KNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences G1TRS4
9986.ENSOCUP00000019732 ENSOCUP00000009191 ENSOCUP00000019732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]